PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g17080.1.p
Common NameBRADI_5g17080, LOC100823840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family DBB
Protein Properties Length: 267aa    MW: 28284.5 Da    PI: 5.6701
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g17080.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.83.8e-07446541
          zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                       C+ +  + ++ fC  ++  lC+ C    H+       H++ +
  Bradi5g17080.1.p  4 LCDVCAAEAASVFCCADEAALCDACDRRVHRAnklagkHRRLS 46
                      7*****************************7688888888765 PP

2zf-B_box25.92e-086294335
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                      ++ C+ ++ek+  lfC++++  lC++C ++ H 
  Bradi5g17080.1.p 62 PPLCDICQEKRGFLFCKEDRAILCRECDVQVHT 94
                      689***************************994 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.1E-10147IPR000315B-box-type zinc finger
PROSITE profilePS5011910.324147IPR000315B-box-type zinc finger
CDDcd000213.27E-7347No hitNo description
PfamPF006434.0E-6446IPR000315B-box-type zinc finger
SMARTSM003367.9E-1560107IPR000315B-box-type zinc finger
PROSITE profilePS501199.75560107IPR000315B-box-type zinc finger
PfamPF006434.4E-761102IPR000315B-box-type zinc finger
CDDcd000211.21E-863107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MKVLCDVCAA EAASVFCCAD EAALCDACDR RVHRANKLAG KHRRLSLLHP SASPSSSAQK  60
PPPLCDICQE KRGFLFCKED RAILCRECDV QVHTASELTR RHGRFLLTGV RVSSAPADSP  120
APSEEEPEDE EEENSCSGGS GSASATASAS ASDGSSISEY LTKTLPGWHV EDFLLDDAAA  180
AASAAAVYLD KPYQGVQAAR TGGVQLQEAS YTAWAGREQR IGGVPVAAGE RARRELWVPQ  240
MSAAGAGAEW TGSSKRPRAP PPYSYW*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240189.10.0PREDICTED: B-box zinc finger protein 20-like
SwissprotQ9LQZ77e-55BBX21_ARATH; B-box zinc finger protein 21
TrEMBLA0A0Q3GS560.0A0A0Q3GS56_BRADI; Uncharacterized protein
STRINGBRADI5G17080.11e-151(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23923679
Representative plantOGRP29841130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39070.13e-28DBB family protein